| |
Indra Neil Sarkar*,
Columbia Department of Medical Informatics
Joseph W. Thornton, Columbia Earth Institute and Department of Biological Sciences
Paul J. Planet, Columbia Department of Cellular
and Molecular Biophysics
[Schierwater]
Rob DeSalle, American Museum of Natural History
Molecular Laboratories |
|
|
The entered sequence is used
to search a database of homeobox consisting of 900 genes inferred from
phylogenetic analysis. Based on the closest
match, the query sequence is then checked for characteristic attributes which
indicate specific classification.
Limitations and important
points:
- This technique is not a replacement
for phylogenetic analysis as it cannot describe the relationships
between individual genes; it only
places sequences in a groups based on the sequences
used to create the phylogeny..
- As new sequences become available
some characteristic attributes may have to be altered or excluded altogether.
Therefore, we will be constantly updating this database.
Diagnostic positions with few possible character
states that represent many taxa in the tree are
the most reliable.
|
| |
|
| |
|
| |
|
Try these sequences:
>HM16.CAEEL
EKRPRTAFTGDQLDRLKTEFRESRYLTEKRRQELAHELGLNESQIKIWFQNKRAKLKKST
>HM19.XENLA
KRKKRTSIEVGVKGALENHFLKCPKPSAHEITSLADSLQ
>PRH.PETCR
KSTSKTLHGEHATQRLLQSFKENQYPQRAVKESLAAELALSVRQVSNWFNNRRWSFRHSS
Just "copy and paste" the full FASTA Amino
Acid Sequence(s) into Query Box: |
|
| |
|
|
|
