GenomeCurator.org
 
PhyloGeNomenClature
for
NTPases

(sans compounds)


Phylogenomenclature is powered by

Written in a collaboration between the
American Museum of Natural History
&
The College of Physicians and Surgeons at Columbia University
 
 



 
Indra Neil Sarkar*, Columbia Department of Medical Informatics
Paul J. Planet, Columbia Department of Cellular and Molecular Biophysics
Rob DeSalle, American Museum of Natural History Molecular Laboratories

The entered sequence is used to search a database of NTPase sequences consisting of 123 genes inferred from phylogenetic analysis. Based on the closest match, the query sequence is then checked for characteristic attributes which indicate specific classification.

Limitations and important points:

  1. This technique is not a replacement for phylogenetic analysis as it cannot describe the relationships between individual genes; it only places sequences in a groups based on the sequences used to create the phylogeny..
  2. As new sequences become available some characteristic attributes may have to be altered or excluded altogether. Therefore, we will be constantly updating this database. Diagnostic positions with few possible character states that represent many taxa in the tree are the most reliable.
   
   
   
Try this sequence (it's a TadA):

MGMEVDEVDMSEKEKGEKAGKFIGEPFDEMMDEEAEIARKRLAVDLGDAEVLAALRQIRSELVGAGPGRL GTEELLEPLLADPGRALRVTDILVNGPDKAPRPPRVWVDRGGGLFPGLERAPIRFADEAEVMRLAQRLAL AAGRRLDSAQPWVDGRLTGIFGDGGSALRVHAVLPPEVNAEVAVDGPCLSIRVLRSKNVSLDEEATKGDD ADCEFFSEARAPAAFTLADLIAAGTITAEAAAAKKILRALVRGLFGVARRAFLISGGTGSGKTTLLSALL AEISIAAVAPDERIVCIEDTAELQPDHIFPHPHVVKLETRPSNPQEGAGEGGEGEVTMRDLVRQALRMRP DRIVVGEVRGAETVVDLLAALNTGHDGCAGTLHANSAREVPARLEALAALNRQGRLHPNGGFNLDRAALH SQLAAALPVVIHPTIRRILGSIYEIRVARGVTDGWEITGPSSEDAIEVARWNEEGAGEEKEHEEDPAGRR RLAEIAELERSQGADDQASGLPITPPATVWEADAFMAEDGAAALRDLLRGAASAEQAVGREAENPATQTIP

Just "copy and paste" the Amino Acid Sequence into Query Box:

   
       
  Enter your Query Protein Sequence (just Amino Acids, please):

 
       
       
 

 
* For program details about PhyloGeNomenclature or CAOS contact: Indra Neil Sarkar, PhD
Division of Invertebrate Zoology
American Museum of Natural History
New York, NY 10024
sarkar@amnh.org
 

GeNomenclature & CAOS are Trademarks of the authors of this website.
CAOS is a Columbia University Patent Pending technology.

© 2002 The Figurski Lab
College of Physicians and Surgeons, Columbia University in the City of New York